PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.101460.1
Common NameCsa_6G486880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 245aa    MW: 27872.5 Da    PI: 9.41
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.101460.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.22.9e-32162220159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk++ +prsYYrCt ++C+vkk+ver a+dp++v++tYeg+H h+
  Cucsa.101460.1 162 LDDGYKWRKYGQKVVKNTLHPRSYYRCTEENCKVKKRVERLADDPRMVITTYEGRHAHS 220
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-33147220IPR003657WRKY domain
SuperFamilySSF1182901.03E-28154221IPR003657WRKY domain
PROSITE profilePS5081129.31157222IPR003657WRKY domain
SMARTSM007747.5E-38162221IPR003657WRKY domain
PfamPF031067.4E-26163219IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGSSASEEEM MVRLLKGGDQ VAAAVNAAAI TTNLICLPEN NNKNNIISVV QQSLKPLFFT  60
TTHHHHQQQE QQSLFPFCFP STTTTSHLLP SSPSSLWDER GVSFMRGRNA IGNYGGEDDH  120
NNENDGKPRL RVSTMKMKRI KGRKKVREPR FSFKTMTDVD VLDDGYKWRK YGQKVVKNTL  180
HPRSYYRCTE ENCKVKKRVE RLADDPRMVI TTYEGRHAHS PSDHNLEDSF MGHLPSSHLT  240
NFFC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26152219774Probable WRKY transcription factor 4
2lex_A2e-26152219774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840310.0GU984031.1 Cucumis sativus WRKY protein (WRKY43) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011656304.10.0PREDICTED: probable WRKY transcription factor 13-like isoform X1
TrEMBLA0A0A0KFC70.0A0A0A0KFC7_CUCSA; Uncharacterized protein
STRINGVIT_07s0031g01840.t012e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40793361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.15e-55WRKY DNA-binding protein 13
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Ling J, et al.
    Genome-wide analysis of WRKY gene family in Cucumis sativus.
    BMC Genomics, 2011. 12: p. 471
    [PMID:21955985]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]